PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g40392.1.p
Common NameBRADI_3g40392
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 415aa    MW: 45265.3 Da    PI: 8.271
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g40392.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.1e-121661146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                      +g+WT+eEde l + v+++G   W++I ++  + Rt+k+c++rw +
  Bradi3g40392.1.p 16 KGPWTAEEDEVLRRHVREHGACEWSSIRSRGLLPRTGKSCRLRWVN 61
                      79*************************8775577**********87 PP

2Myb_DNA-binding42.81.2e-1372112345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       ++++eE+   +++ +q+G++ W++Ia +++ gRt++++k++w 
  Bradi3g40392.1.p  72 KFSAEEERVVIELQAQFGNK-WARIATYLP-GRTDNDVKNFWS 112
                       79******************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.381163IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-191264IPR009057Homeodomain-like
SuperFamilySSF466891.46E-2714111IPR009057Homeodomain-like
SMARTSM007172.0E-111565IPR001005SANT/Myb domain
CDDcd001671.03E-111863No hitNo description
PfamPF139213.8E-111969No hitNo description
PROSITE profilePS5129420.51164119IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-1865117IPR009057Homeodomain-like
SMARTSM007173.5E-1269117IPR001005SANT/Myb domain
CDDcd001671.54E-1072111No hitNo description
PfamPF002497.2E-1272112IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MQPRGRGERM SAAVKKGPWT AEEDEVLRRH VREHGACEWS SIRSRGLLPR TGKSCRLRWV  60
NKLRPNLKTG CKFSAEEERV VIELQAQFGN KWARIATYLP GRTDNDVKNF WSTRQKRLAR  120
ILRAPLRPRT RRSAAAAKRQ IRAGGSGAVS SSSPSTAAAP SHSQELLPTG QASEPLYQVQ  180
DHRPCFDMIP FHEPTMHDHH IIGQSWSQEP PPLTQCADAG KQNGEYLCQV QVRERPCFPT  240
IPFQQPPPLP TTRHYIIGQS SQEPPSPPPM ANPRCADTSL LFPGLLGPGP VPPSPVAGFA  300
SATGICGSSS YGAAPPALSF HHPLSFLCAG DPTPMVDPAA TLAGNGGVPY LEPKPEQAQQ  360
PPPLGFFGLE EEYVDEYGLL GGLVRRDTIF DDLAPEMFDF FELSPSPPPP STGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-251011721126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0Q3FIE00.0A0A0Q3FIE0_BRADI; Uncharacterized protein
STRINGSi015815m3e-72(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57003357
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.12e-57MYB family protein